Are We Transitioning to Doom or Doomed to Transition? (EXCERPT)
Channel: Prof. Sam Vaknin
Category: News & Politics
Tags: civilizationdoomgoodscasual sexaversionrelationshipsvictimhoodnormativeempirecolonialismpsychopathymagical thinkingmonarchyinsanitymental illnesscitiesworkentitlementhistoryurbanizationinstitutionsself-cenrednessdistrustscienceself-sufficiencywomenlovegenderdeathyoungideologycommoditiesagricultureintimacymenpowersubstance abusenormalmiddle agessexconsumptiontransitiondystopiamaterialinfidelitydignityrisknarcissismfamily
Description: Period of multiple transitions with no elites or institutions (clan, tribe, family, church, lord, guild) to cushion, comfort, and buffer changes. POLITIES From monarchies to unstable empires with inner tensions to multiple experimental political systems, still contested. ECONOMIES Population pressure and surpluses led from agriculture to urbanization, colonialism, imperialism, mercantilism, and Industrialization and have decoupled production from consumption, resulting in anonymous ad hoc communities (teams, unions, nuclear families) FAMILY and GENDER Monogamous family: artefact of hierarchical agricultural state and need to regulate surpluses (wealth). Patriarchy in public domain and matriarchy in private domain. We are transitioning to matriarchy in both the private and the public domain. Outsourcing of family functions, medical and technological innovations emancipated women, upended the power matrix, reduced procreation, eliminated obsolete gender (unigender, masculinization in stalled revolution), homoegenized sexual scripts, and caused reactionary war (backlash) with men. Women and men are angry at each other, contemptuous, distrustful, and no longer rely on each other. KNOWLEDGE Democratization of knowledge: vernacular bible, universities, printing, internet led to populism, anti-enlightenment, ochlocracies, and totalitarianism. REALITY Now we are transitioning from first generation virtual reality (cities) to second generation: cyberspace/metaverse and social media: atomization, individual anonymity, self-worship, and self-sufficiency.
